Description
Book Synopsis: A deep dive into the spectrum of Autistic experience and the phenomenon of masked Autism, giving individuals the tools to safely uncover their true selves while broadening society’s narrow understanding of neurodiversity“A remarkable work that will stand at the forefront of the neurodiversity movement.”—Barry M. Prizant, PhD, CCC-SLP, author of Uniquely Human: A Different Way of Seeing Autism
For every visibly Autistic person you meet, there are countless “masked” Autistic people who pass as neurotypical. Masking is a common coping mechanism in which Autistic people hide their identifiably Autistic traits in order to fit in with societal norms, adopting a superficial personality at the expense of their mental health. This can include suppressing harmless stims, papering over communication challenges by presenting as unassuming and mild-mannered, and forcing themselves into situations that cause severe anxiety, all so they aren’t seen as needy or “odd.” In Unmasking Autism, Dr. Devon Price shares his personal experience with masking and blends history, social science research, prescriptions, and personal profiles to tell a story of neurodivergence that has thus far been dominated by those on the outside looking in. For Dr. Price and many others, Autism is a deep source of uniqueness and beauty. Unfortunately, living in a neurotypical world means it can also be a source of incredible alienation and pain. Most masked Autistic individuals struggle for decades before discovering who they truly are. They are also more likely to be marginalized in terms of race, gender, sexual orientation, class, and other factors, which contributes to their suffering and invisibility. Dr. Price lays the groundwork for unmasking and offers exercises that encourage self-expression, including:
- Celebrating special interests
- Cultivating Autistic relationships
- Reframing Autistic stereotypes
- And rediscovering your values
It’s time to honor the needs, diversity, and unique strengths of Autistic people so that they no longer have to mask—and it’s time for greater public acceptance and accommodation of difference. In embracing neurodiversity, we can all reap the rewards of nonconformity and learn to live authentically, Autistic and neurotypical people alike.
Details
Umskgusm:DsvergheewFesfeurdversysgrudbrekgbkhdeveshesperumfusexpereedkeshessuefmskedusm.hsmus-redresureprvdesdvduswhhessfeyuverherrueseves,whesheggsey'smedudersdgfeurdversy.Whspwerfusghs,hsbkwudubedysdhefrefrfheeurdversymveme.
dy'swrd,freveryvsbyuspersyueuer,herereuessherswhmskherrueseveseffrfwhserms.hsmmpgmehsm,kwsmskg,hvedermeeffesdvdu'smeheh.Umskgusm,wrebyDr.DevPre,shedsghhsphemebymbgpersexperees,sseereserh,dpersprfes.'smemvewyfrmheperspevefusdersdruyudersdhebeuyduqueessfeurdvergee.
Dr.Preemphszeshesruggeshmskedusdvdusfefryersbefredsvergherruedees.hesesruggesreexerbedbymrgzermsfre,geder,sexure,ss,dherfrs.hsbkprvdesprexersesheurgesef-expressdempwerme.Frmeebrgspeeressrefrmgussereypes,Dr.Pregudesrederswrdsredsvergherwvuesdembrgheruhey.
hemehsmehrheeeds,dversy,duquesreghsfusdvdus.Byfserggreerpubepedmmdfdfferee,webeeffrmherewrdsffrmy.hsbksfrbhusdeurypdvdusembreeurdversydveuhey.D'mssuheppruyrsfrmyurudersdgfusmdrbuemreusvewrd.
Discover More Best Sellers in Health, Fitness & Dieting
Shop Health, Fitness & Dieting
Atomic Habits: An Easy & Proven Way to Build Good Habits & Break Bad Ones
Health, Fitness & Dieting - Atomic Habits: An Easy & Proven Way to Build Good Habits & Break Bad Ones
Health, Fitness & Dieting - Tiny Humans, Big Emotions: How to Navigate Tantrums, Meltdowns, and Defiance to Raise Emotionally Intelligent Children―An Essential Guide for Caregivers of Children from Infancy to Age Eight
The Blue Zones Challenge: A 4-Week Plan for a Longer, Better Life
Health, Fitness & Dieting - The Blue Zones Challenge: A 4-Week Plan for a Longer, Better Life
Health, Fitness & Dieting - Fuck It: A Guided Self-Love and Gratitude Journal for Women to Unfuck Your Life, Exhale the Bullshit, and Love Who You Are (Cute Self Care & Self Help Books)
Skinnytaste High Protein: 100 Healthy, Simple Recipes to Fuel Your Day: A Cookbook
Health, Fitness & Dieting - Skinnytaste High Protein: 100 Healthy, Simple Recipes to Fuel Your Day: A Cookbook
Health, Fitness & Dieting - The Subtle Art of Not Giving a F*ck: A Counterintuitive Approach to Living a Good Life (Mark Manson Collection Book 1)
Health, Fitness & Dieting - Fast. Feast. Repeat.: The Comprehensive Guide to Delay, Don't Deny® Intermittent Fasting--Including the 28-Day FAST Start
Health, Fitness & Dieting - The Glucose Goddess Method: The 4-Week Guide to Cutting Cravings, Getting Your Energy Back, and Feeling Amazing


