From Oversight to Overkill: Inside the Broken System That Blocks Medical Breakthroughs—And How We Can Fix It
$22.95
Description
BkSypss:Medreserhsvesves—yefe,shwredbyrevewsysemsuppsedsfegurdpeshsedreeseedessdeysdexpese.suRevewBrds,whhexseveryhspdmedshhdusmedreserh,hveededupmpsgsuhmpex,drdshreserhsfrequeydmged,deyed,ddsred.hsswhymedmreskeheVD-19ves,whhweredevepedwrpspeed,refrrre.sed,medreserhuessresskephrse-d-buggype.heresu:ueessrysuffergdvdbedehs.
Frmversghverkvvdyreushesrybehdhsrss,ehremsukwhegeerpub.FmyphysdehsSmWheyshwshwheRBsysemwsuhedrespsesdskeherususkegeesyphssudy—dhw,reededes,hswe-eedprgrmhsbemeresgybureur,vued,dsfg.
RederswerhwvbrekhrughsregdsfrmkdeysesherksdpremurebrhhvebeedeyedbyRBredpe,frgdrsdpesseefress-effeveremes.hey’seehw-frmeddemdsfrmgressedershregurs“geugh”sesshveusedrespeedreserhsusbeshudw—whbeefhepub.dhey’erbubed,mm-sesepprhrefrmghesysemhfreesessfrmpesswhee-spgwhespreghepubfrmhersksfuehrreessexperme.
Uw,hedebebuheRBsysem’sfureshsbeefedspeyjursmede,w,dehs.Frmversghverkwfyerzesbuhse-kwrsswhmer’smedreserhsysem—dwhbedebu.
“SmWheyrevessdheveryseskwsbuehsmuseredheurgeppse:fesvgreserhheUSsrppedbymdess,Kfkesquebureurydededpregpesbuvergsderrèredexpdgsfefdm.Frmversghverkwudbewhz-bgbkevefjusbewhewhsehsurge,bu’ssseergsymedbesseer,eveedwhufrgebesresdvgrus,wyprse.”—SevePker,JhsePrfessrfPsyhgy,HrvrdUversy,dheuhrfEghemewdRy
"Mkgheurgesehversghdewrgmsru,smemesfe-svgpsfrpesddrs,WheysfrewpprhhwsurevewperesfrmedreserhvvghumsubjesheU.S....gesysdpersusvesrurfrgumes,[heffers]vgrgumefrrefrmbeerservepesdsey.”—PubshersWeekyBkfe(Edr’sPk)
“refuyresedddsurbgprrfpehzrdsfexessveregu.”—KrkusRevews
“fyu’reeresedreserh,redhsbk!sdrbegsRBs.’smkehemmrehume.shghyredbedpersusve.”—RhdesdMedJur
“Frmversghverksquesmpy"mushve"refereefrbrresrehggeer-eresprsdhehprfesss.dey,w'jusrepsebrrysheves,buwberemmededrederdhehredsussgrupsfrsmysghsdedveydebesmghehreprfesssdusersfhemermedsysem.”—MdwesBkRevew
Details
Are you tired of waiting for medical breakthroughs that can save lives? Look no further! Introducing "From Oversight to Overkill: Inside the Broken System That Blocks Medical Breakthroughs—And How We Can Fix It" – a revolutionary book that exposes the flaws in our current medical research system and provides a clear roadmap for positive change.
Unbeknownst to the general public, the review system designed to protect patients has become a bureaucratic nightmare that hampers progress. This book, written by esteemed family physician and ethicist, Simon Whitney, unveils the truth behind the inefficiencies that have plagued medical research for far too long.
In "From Oversight to Overkill," you'll discover how archaic regulations imposed by Institutional Review Boards (IRBs) have slowed down potentially life-changing breakthroughs in treatments for various ailments, from kidney stones to heart attacks and premature birth. Whitney sheds light on the unnecessary suffering and avoidable deaths that result from this broken system.
Not only does this book expose the flaws, but it also provides a balanced and commonsense approach to reform. By freeing scientists from pointless bureaucratic hurdles, we can accelerate the pace of medical breakthroughs while still ensuring ethical standards are upheld and patient safety remains a top priority.
Don't let this crisis in our medical research system go unnoticed. Join the movement for change and empower yourself with knowledge. Take action today by clicking the link below to learn more about "From Oversight to Overkill" and how we can fix the broken system that stands in the way of life-saving medical advancements.
Click here to access the book that will shed light on this little-known crisis and ignite the change we desperately need.
Discover More Best Sellers in Research
Shop Research
            
            
            $22.42
 Research - The Physician's Guide to Finance: Personal Finance for Medical Students, Residents, and Attending Physicians
        
            Oxford Handbook of Clinical and Healthcare Research (Oxford Medical Handbooks)
$37.40
 Research - Oxford Handbook of Clinical and Healthcare Research (Oxford Medical Handbooks)
        
            
            
            $257.38
 Research - Precision Medicine in Neurodegenerative Disorders: Part II (Volume 193) (Handbook of Clinical Neurology, Volume 193)
        
            Publishing and Presenting Clinical Research
$50.64
 Research - Publishing and Presenting Clinical Research
        
            
            
            $1.91
 Research - The Telomerase Revolution: The Enzyme That Holds the Key to Human Aging . . . and Will Soon Lead to Longer, Healthier Lives
        
            Design, Execution, and Management of Medical Device Clinical Trials
$32.89
 Research - Design, Execution, and Management of Medical Device Clinical Trials
        



